SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096LRM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096LRM3
Domain Number 1 Region: 566-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 2 Region: 119-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000316
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 66-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 520-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000453
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096LRM3
Sequence length 611
Comment (tr|A0A096LRM3|A0A096LRM3_POEFO) Complement component 8, alpha polypeptide {ECO:0000313|Ensembl:ENSPFOP00000021814} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
LLKFQSSSLIIFKMGTFNHVVVALCALYLFINPTVNATRKPWTTSQTRCNAMMLRRIRAA
NSPAPIDCRVGRWSSWTRCDSCTDKTLRFRHLEKPAQFGGTDCVGTLWDRLACPTATTQC
MVKDYCGESFTCKETGRCISQSLRCNGEPDCDDFSDEDECDRITQREDKCSTLIPIPGAE
RGTQGYNLLTGDFMDQVLDPKYFGGKCEYVYNGEWSKLMYDAFCESLQYNEDEKNYRKPY
NYHTYSFVAEATSKGSDEYFEDMQRLLEARQSMSSSNFGVSVGIAFVDIGVNKNAESEFL
NNITKYQSQDFSFIRVWSKVQTAHFKMRSNQLMLHEDFYIALMELPEQYDFGVYSRFLNT
FGTHYVTEGTMGGSLEYVAVLNKTAMAKSNIDAKRFQSCFGTSLGISYSFSEEAALGIKV
KTSSCETNKEDFKANSSESAVVEDIIKLVKGGITETGSGLLVIRDQDTYRKWGASLKYNP
ALTDFEILPIFEAVRLSTAADHAGARIDNLERAIEEYLREFDTCRCAPCRHNGIPVRSGT
SCSCICKPGFRGVACEETLRRDARTDGSWSCWGSWSSCSSGTKSRTRICNNPSPEGGGAP
CLGSANQNRRC
Download sequence
Identical sequences A0A096LRM3
ENSPFOP00000012219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]