SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MKR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MKR0
Domain Number 1 Region: 160-318
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.3e-51
Family Myf domain 0.0000000388
Further Details:      
 
Weak hits

Sequence:  A0A096MKR0
Domain Number - Region: 22-75
Classification Level Classification E-value
Superfamily t-snare proteins 0.0204
Family t-snare proteins 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MKR0
Sequence length 321
Comment (tr|A0A096MKR0|A0A096MKR0_PAPAN) Aminoacyl tRNA synthetase complex interacting multifunctional protein 1 {ECO:0000313|Ensembl:ENSPANP00000000086} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=AIMP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MIFCRLLAKMANNDAVLKRLEQKGAEADQIIEYLKQQISLLKEKAILQATLREEKKLRVE
NAKLKKEIEELKQELIQAEIQNGVKQIPFPSGTPLQANSMVSENVVQSTPLTAVSSGTKE
QIKGGTGDEKKAKEKIEKKGEKKEKKQQSVAGSADSKPIDVSRLDLRIGCIITARKHPDA
DSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMLMCAS
SPEKVEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGV
PFEVKGKGLCRAQTMSNSGIK
Download sequence
Identical sequences A0A096MKR0
ENSPANP00000000086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]