SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096ML88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096ML88
Domain Number 1 Region: 379-577
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-69
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 100-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096ML88
Sequence length 579
Comment (tr|A0A096ML88|A0A096ML88_PAPAN) Nuclear receptor subfamily 1 group D member 2 {ECO:0000313|Ensembl:ENSPANP00000000300} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NR1D2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL
SNIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTTLPAQEQLRPKPQLEQENIKS
SSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQRENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG
DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLI
MKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences A0A096ML88
ENSPANP00000000300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]