SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MMI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MMI6
Domain Number 1 Region: 55-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.14e-44
Family Regulator of G-protein signaling, RGS 0.000000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MMI6
Sequence length 202
Comment (tr|A0A096MMI6|A0A096MMI6_PAPAN) Regulator of G protein signaling 16 {ECO:0000313|Ensembl:ENSPANP00000000819} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGS16 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSSGKFEWGSKHGKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIQSATKRASRAHRIFEE
FICSEAPKEVNIDHETRELTRMNLQTVTATCFDTAQGKTRTLMEKDSYPRFLKSPTYRDL
AAQASAASATPSSCSLAEPSHT
Download sequence
Identical sequences A0A096MMI6
ENSPANP00000000819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]