SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MN72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MN72
Domain Number 1 Region: 461-635
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 613-712
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.09e-17
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Domain Number 3 Region: 780-971
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000274
Family Calmodulin-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MN72
Sequence length 1065
Comment (tr|A0A096MN72|A0A096MN72_PAPAN) TBC1 domain family member 8B {ECO:0000313|Ensembl:ENSPANP00000001076} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=TBC1D8B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MWLNPEEVLLKNALKLWLMERSNDYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKV
APFRILHQTPDSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIR
GLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLPEKEKLVTYYSCSYWKGRVPCQGWLYL
STNFLSFYSFLLGSEIKLIISWDEVSKLEKTSNVILTESIHVCSQGENHYFSMFLHINQT
YLLMEQLANYAIRRLFDKETFDNDPVLYNPLQITKRDLENRAHSEQFNAFFRLPKGESLK
EEHECFLWVPFSHFNTHGKMCISENYICFASQDGNQYSVIIPLREVLAIDKTNDSSKSVI
ISIKGKTAFRFHEVEDFEQLVAKLRLRCGAASAQYHDISTELAISSESTEPSDNLEAQSS
TSQRECGKTVNTEALMMVFHPQNLETLNSKMLKEKMKEQSWKILFAECGRGVSMFRTKKT
RGLVVRGIPETLRGELWMLFSGAVNDMATNPGYYAEVVEQSLGTCNLATEEIERDLRRSL
PEHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCE
RMLPDYFNRRIIGALVDQAVFEELIRDHLPQLTEHMTDMTFFSSVSLSWFLTLFISVLPI
ESAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAEAVTALNRFFDNVTNKDSPL
PSNVQRGSNVSDEKTSHTRVDITDLIRESNEKYGNIRYEDIHSMRCRNRLYVIQTLEETT
KQNVLRVVSQDVKLSLHELDELYVIFKKELFLSCYWCLGCPVLKHHDPSLPYLEQYQIDC
QQFRALYHLLSPWAHSANRDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLK
LLFKLHIPPAYTEVKSKDTSKGDELSKEELLYFSQLHVSKPENEKEEESAKHSPEKGKGK
IDIQAYLSQWQDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVT
SLLLRMEEVGRKLHSPTSSAKGFSGFFGLKKKMDWKMQLKLLPSL
Download sequence
Identical sequences A0A096MN72
ENSPANP00000001076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]