SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MQ72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MQ72
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily PX domain 1.44e-43
Family PX domain 0.0000000909
Further Details:      
 
Domain Number 2 Region: 217-331
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-26
Family SH3-domain 0.000000504
Further Details:      
 
Domain Number 3 Region: 155-217
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-19
Family SH3-domain 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MQ72
Sequence length 390
Comment (tr|A0A096MQ72|A0A096MQ72_PAPAN) Neutrophil cytosolic factor 1 {ECO:0000313|Ensembl:ENSPANP00000001894} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NCF1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGDTFIRHIALLGFEKRFVPNQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPI
EAGAINPENRTIPHLPAPRWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKV
RPNDLKLPTDNQTKKPETYLLPKDGKSTAADITGPIILQTYRAIADYEKTSGSEMALAMG
DVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYAAV
EEDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP
RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEEPQTQRSK
PQPAVPPRPSADLILNRCSESTKRKLASAV
Download sequence
Identical sequences A0A096MQ72 A0A2K5Z934
XP_011850618.1.47321 ENSPANP00000001894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]