SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MRK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MRK8
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.24e-50
Family LplA-like 0.0000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MRK8
Sequence length 231
Comment (tr|A0A096MRK8|A0A096MRK8_PAPAN) Putative lipoyltransferase 2, mitochondrial {ECO:0000256|PIRNR:PIRNR016262} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=LIPT2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGTEASSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVAALE
ACAVRLCELQGLQDARARSPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHVTVDEVMPPFLVAFKEIYKCTLISEDSPN
Download sequence
Identical sequences A0A096MRK8
ENSPANP00000002410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]