SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MRS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MRS8
Domain Number 1 Region: 544-634
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000734
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 
Weak hits

Sequence:  A0A096MRS8
Domain Number - Region: 57-116
Classification Level Classification E-value
Superfamily TPR-like 0.0488
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MRS8
Sequence length 801
Comment (tr|A0A096MRS8|A0A096MRS8_PAPAN) Nuclear autoantigenic sperm protein {ECO:0000313|Ensembl:ENSPANP00000002485} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NASP OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MALFRSLVRHLRGTMATESTATAAVAAELVSANKIEDVSAPSTSADKVESLDVDSEAKKL
LGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVL
GNALEGVHVEEEEGEKTEDESLAENNDNIDEEAREELREQVYDAMGEKEEAKKTEDKSLA
KPETNKEQDSEVKKGGREDMDISESAEEPQEKVDLTLDWLTETSEEAKGGTAPEGPNEAE
VTSGKPEQEAPDAEEEKSVSGTDVQEECRGKGQEKQGEVIVSMEEKPREVSEEQPVVTVE
KQGTAVELEAESLDPTVKPVDVGGDEPEEKVVTSEHEAGKVVLEQLVGQEVPPAEESPEG
TAEAAEAAAVEAGSEVSEKPGQEATVLPKDGAVNGPSAVGDQTPIEPQTSIERLTETKDG
SGLEEKVRAKLVPSQEETKLSVEESEAAGDGVDTKVAQGATEKSTEDKVQIAANEETQER
EEQMKEGEETEGSEEDDKENDKTEEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLAKI
IFKRQETKEAQLYAAQAHLKLGEVSVESENYVQAVEEFQSCLNLQEQYLEAHDRLLAETH
YQLGLAYGYNSQYDEAVAQFSKSIEVIEKRMAVLNEHVKEAEGLSAEYKKEIEELKELLP
EIREKIEDAKESQHSGNVAELALKATLVESSTSGFTPSGGGSSVSMIAGRKPTDGASSSN
CVTDISHLVRKKRKPEEESPRKDDAKKAKPEPEVNGGSGDAVPSGNEVSENMEEEAENRA
ESRAAVEATVEAGATVESTAC
Download sequence
Identical sequences A0A096MRS8
ENSPANP00000002485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]