SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MS13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MS13
Domain Number 1 Region: 6-118
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.6e-27
Family Nuclear movement domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MS13
Sequence length 157
Comment (tr|A0A096MS13|A0A096MS13_PAPAN) NudC domain containing 2 {ECO:0000313|Ensembl:ENSPANP00000002573} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NUDCD2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGRE
ILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQR
KLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK
Download sequence
Identical sequences A0A096MS13 A0A0D9RD46 A0A2K5J8M3 A0A2K5ZCS7 A0A2K6KA66 A0A2K6P1B4 F7CKN8 G2HIJ2 G3R377 H2PHA6 Q4R6U9 Q8WVJ2
ENSPTRP00000029899 ENSGGOP00000009698 9544.ENSMMUP00000025683 9598.ENSPTRP00000029899 9600.ENSPPYP00000017927 9606.ENSP00000304854 ENSPTRP00000029899 ENSPPYP00000017927 ENSPPYP00000017927 ENSMMUP00000025683 ENSP00000304854 ENSGGOP00000009698 ENSP00000304854 ENSP00000304854 ENSPANP00000002573 gi|21687129|ref|NP_660309.1| ENSMMUP00000025683 NP_001233494.1.37143 NP_001270520.1.63531 NP_660309.1.87134 NP_660309.1.92137 XP_001082159.1.72884 XP_002816207.1.23681 XP_004043001.1.27298 XP_008013421.1.81039 XP_010365654.1.97406 XP_011803123.1.43180 XP_011853174.1.47321 XP_014996851.1.72884 XP_017744520.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]