SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MT69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MT69
Domain Number 1 Region: 412-473
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.09e-16
Family LIM domain 0.0031
Further Details:      
 
Domain Number 2 Region: 470-540
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000181
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  A0A096MT69
Domain Number - Region: 382-415
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0642
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MT69
Sequence length 572
Comment (tr|A0A096MT69|A0A096MT69_PAPAN) Zyxin {ECO:0000313|Ensembl:ENSPANP00000002993} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ZYX OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
LEEEGGPEAPIPSPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FISKSSTKPAAGGTAPLPPWKAPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQS
QPQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPAPAQNQNQVRSPGAPGPLTLKEVEELE
QLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCESCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
SFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDC
GKPLSIEADDNGCFPLDGHVLCRKCHTARAQS
Download sequence
Identical sequences A0A096MT69 A0A2K6C152 H9ZDD0
ENSMMUP00000016598 NP_001247977.1.72884 XP_011721831.1.29376 XP_011721832.1.29376 XP_011721833.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]