SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MTE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MTE8
Domain Number 1 Region: 471-674
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-45
Family Nuclear receptor ligand-binding domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 418-500
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MTE8
Sequence length 676
Comment (tr|A0A096MTE8|A0A096MTE8_PAPAN) Nuclear receptor subfamily 3 group C member 1 {ECO:0000313|Ensembl:ENSPANP00000003077} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NR3C1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MDSKESLTPSREENPSSVLAQERGNVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKSSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENAKSSASTAVSAAPTKKEFPKTHSDGSSEQQNLKGHTGTNGGN
VKLYTADQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPNNATLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSGW
Download sequence
Identical sequences A0A096MTE8
ENSPANP00000003077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]