SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MUX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MUX7
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.68e-34
Family Synaptotagmin-like (S variant) 0.000000716
Further Details:      
 
Domain Number 2 Region: 146-270
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.12e-32
Family Synaptotagmin-like (S variant) 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MUX7
Sequence length 425
Comment (tr|A0A096MUX7|A0A096MUX7_PAPAN) Synaptotagmin 4 {ECO:0000313|Ensembl:ENSPANP00000003646} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=SYT4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGV
DIYPENLNSKKKFGADDKNEVKNKPTVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLEN
ATPKLFLEGEKEAVSPDSLKSSTSLSSEEKQEKLGTLFFSLEYNFEKKAFVVNIKEARGL
PAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHF
TILSFDRFSRDDVIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQST
TNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVF
DIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
VLCDG
Download sequence
Identical sequences A0A096MUX7
ENSPANP00000003646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]