SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MVP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MVP9
Domain Number 1 Region: 169-365
Classification Level Classification E-value
Superfamily E set domains 8.4e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000114
Further Details:      
 
Domain Number 2 Region: 64-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.27e-20
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096MVP9
Sequence length 501
Comment (tr|A0A096MVP9|A0A096MVP9_PAPAN) Potassium voltage-gated channel subfamily J member 3 {ECO:0000313|Ensembl:ENSPANP00000003933} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=KCNJ3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
Download sequence
Identical sequences A0A096MVP9 A0A0D9RTV7 A0A2J8V791 A0A2K5KAS7 A0A2K5KUQ0 A0A2K5R993 A0A2K5VD51 A0A2K5ZAX7 A0A2K6DSK6 A0A2K6KTD1 A0A2K6N7J1 A0A2K6T1A2 F7AN67 F7ERG6 G3SFZ4 H2QIU3 P48549
gi|4504839|ref|NP_002230.1| ENSPANP00000003933 ENSCJAP00000028522 ENSCJAP00000028533 9544.ENSMMUP00000009298 9598.ENSPTRP00000021446 9606.ENSP00000295101 ENSPTRP00000021446 NP_001248625.1.72884 NP_002230.1.87134 NP_002230.1.92137 XP_001141809.3.37143 XP_002749477.1.60252 XP_003832766.1.60992 XP_003922019.1.74449 XP_005573262.1.63531 XP_007963181.1.81039 XP_010386070.1.97406 XP_011759059.1.29376 XP_011782845.1.43180 XP_011847355.1.47321 XP_011893795.1.92194 XP_017378680.1.71028 XP_017709066.1.44346 XP_018878367.1.27298 ENSPTRP00000021446 ENSP00000295101 ENSP00000295101 ENSP00000295101 ENSMMUP00000009298 ENSMMUP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]