SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MX28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MX28
Domain Number 1 Region: 71-123,275-311,438-462
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000919
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 2 Region: 229-462
Classification Level Classification E-value
Superfamily TPR-like 0.00000465
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MX28
Sequence length 569
Comment (tr|A0A096MX28|A0A096MX28_PAPAN) Tetratricopeptide repeat domain 22 {ECO:0000313|Ensembl:ENSPANP00000004438} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=TTC22 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAEPEAVADDLDALIDDLDYLPGHFHLEMQLNFEPHSPAPQRARDMKLQREGLRQELELA
AAPQRPAVRHLLGAFAFYLEELDEARECFLEVTREHPGNLNAWANLAHVYGRLGQEEEEE
ACAARLASLMGLAEEPEAAGDPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALY
DKALGYGQQIPMEEKRGWYFTMATLYIRLDGIFLELGSEEQKRLPAFNRTLALLRQVLKS
EDPRHQALAWCYLGMLLERNDTFSTTPMGVHDCGYSGTDPLDCFGKAIEIAKNQPPILNR
LAKIFYFLGKQDMAIGTCNMALDVLQDPELNWQAYCTRAKIHIRAYLHDLERAKMGLGGM
PDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLA
KAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTEGFGCLLEALL
AQWSQAQLSDGELGREVDAWLRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGR
LALVRLLFETMEREGEGASAPRDRRAVSF
Download sequence
Identical sequences A0A096MX28
ENSPANP00000004438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]