SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MYR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A096MYR7
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000294
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096MYR7
Sequence length 423
Comment (tr|A0A096MYR7|A0A096MYR7_PAPAN) Nucleoporin like 2 {ECO:0000313|Ensembl:ENSPANP00000005087} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NUPL2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQSSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPSFGSFDSGASTNRKEGFGLSENPFGSLSPDEQKDEKKLLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQH
LINQWRNRVNELKSLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFVSPGFPVNNSSS
DNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSAISTSAPAFGFGKPEVTSAAS
FSFKSPAASSFGSPGFSGLPTSLATGSIRAPVAPAFGGGSSVAGFGSPSSHSHTAFSKPS
SDTFGNSSISTSLSASSSIFATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL
LNI
Download sequence
Identical sequences A0A096MYR7 F7G4R2 G7P0R1
ENSMMUP00000002083 ENSPANP00000005087 ENSMMUP00000002083 9544.ENSMMUP00000002083 NP_001253108.1.72884 XP_005550048.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]