SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MZR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MZR6
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.23e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 225-354
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.05e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 414-474
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000118
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MZR6
Sequence length 486
Comment (tr|A0A096MZR6|A0A096MZR6_PAPAN) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSPANP00000005472} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=WAS OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLLPPPPPANEERRGGLPPLPPH
PGGDQGGSHSLILAPQSLSGQERARGLHYERREGRAVGIHWSLFTSPRHVTHVGWDPQNG
FDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPP
PPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGVAPPPPTPRGPPPPGRGGPLPPPPPATGR
SGPPPPPPPGAGGPPMPPPPPPPPPPPPSSGNGPAPPLLPPALVPAGGLAPGGGRGALLD
QIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDE
DDEWDD
Download sequence
Identical sequences A0A096MZR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]