SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N0C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N0C5
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.15e-46
Family Regulator of G-protein signaling, RGS 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096N0C5
Sequence length 211
Comment (tr|A0A096N0C5|A0A096N0C5_PAPAN) Regulator of G protein signaling 2 {ECO:0000313|Ensembl:ENSPANP00000005707} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGS2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MQSAMFLAVQHDCRPMDTSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
Download sequence
Identical sequences A0A096N0C5 A0A0D9RLP3 A0A2K5MUH8 A0A2K6C5Z9 A0A2K6L4Q4 A0A2K6N7N9 F7HBZ1 G7NXE1
NP_001252854.1.72884 XP_005540321.1.63531 XP_010373849.1.97406 XP_011744747.1.29376 XP_011927112.1.92194 XP_017747093.1.44346 9544.ENSMMUP00000022669 ENSMMUP00000022669 ENSMMUP00000022669 ENSPANP00000005707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]