SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N1T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N1T4
Domain Number 1 Region: 422-516
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.01e-16
Family Glucose-inhibited division protein B (GidB) 0.07
Further Details:      
 
Domain Number 2 Region: 249-332
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000877
Family Glutathione S-transferase (GST), C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096N1T4
Sequence length 633
Comment (tr|A0A096N1T4|A0A096N1T4_PAPAN) Glutathione S-transferase C-terminal domain containing {ECO:0000313|Ensembl:ENSPANP00000006271} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=GSTCD OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MKAIKKSLTEEEYLYLDFSHQTKGCIFPLHTSVTLFLLSYCDCKIFKICLVVTKEVSTDS
SLLRDDLIQDVEIQIISRQELPPIVQNCCLPAVVERSDNFCRAGLAVVLRHIIQKSCEAD
PLKKELLELLGFKKTCLKACAEVSQWTRLCELTIPLAIENFLRESSDQPPTIPVEILQLE
KKLSEPVRVHNDDKLRRQKLKQQKADGVGPPLTKGKAKSKVHTQETSEELDSSSESLELK
VAFSKLTVREEPATTNREPSHIRKAKASDLPPLEHVFAEGLYFTLADIVLLPCIHHFLVI
ICKKFSEKLVEFPLLASWYQRIQEVPRVKTAASKCGIQFLHLPKLLTVSTEQRPNLSEVP
GVEEHSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTVDWNVLPAAVSPKEGKMSSDR
ALRKQQQLNNLVYVVTNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIR
AKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCC
YGFIQNTSKFNFPKSEQFKKTLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDR
ARAAEECGYSVQVISMEPESCSPKNNMIVGVPI
Download sequence
Identical sequences A0A096N1T4
ENSPANP00000006271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]