SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N204 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N204
Domain Number 1 Region: 406-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-36
Family DEP domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-23
Family DIX domain 0.0018
Further Details:      
 
Domain Number 3 Region: 228-338
Classification Level Classification E-value
Superfamily PDZ domain-like 3.33e-23
Family PDZ domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096N204
Sequence length 716
Comment (tr|A0A096N204|A0A096N204_PAPAN) Dishevelled segment polarity protein 3 {ECO:0000313|Ensembl:ENSPANP00000006345} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=DVL3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
Download sequence
Identical sequences A0A096N204 H9ENW4
XP_005546579.1.63531 XP_011736892.1.29376 XP_014986972.1.72884 ENSPANP00000006345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]