SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N293 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N293
Domain Number 1 Region: 61-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000775
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  A0A096N293
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00366
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096N293
Sequence length 690
Comment (tr|A0A096N293|A0A096N293_PAPAN) Adhesion G protein-coupled receptor L4 {ECO:0000313|Ensembl:ENSPANP00000006436} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ADGRL4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MKLLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTICIENVNANCHLDNA
CIAANINKTLTKIRPIKEPVALLREVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTI
SVKDTLSNSTLTELVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVERATLRLSQSF
QKTTQFDTNSTDIALKVFFIDSSKMKHIHPHMNVDGDYINIFPKRKAAYNSNGNVAVAFL
YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPMLYELEKITFTLSHR
KITDRYKSLCAFWNYSPDTMNGTWSSEGCELTYSNETHTSCRCNHMTHFAILMSSGPSIG
IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS
PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences A0A096N293
ENSPANP00000006436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]