SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N2A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N2A9
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00043
Further Details:      
 
Domain Number 2 Region: 211-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096N2A9
Sequence length 442
Comment (tr|A0A096N2A9|A0A096N2A9_PAPAN) GATA binding protein 4 {ECO:0000313|Ensembl:ENSPANP00000006452} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=GATA4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGAAGGSSGAAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGSESLPPTSGASSNSSSATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSLHPVLSALKLSPQGYVSPVSQSPQT
SSKQDSWNSLVLADSHGDIITA
Download sequence
Identical sequences A0A096N2A9
ENSPANP00000006452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]