SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N3E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N3E1
Domain Number 1 Region: 6-331
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.83e-60
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000002
Further Details:      
 
Domain Number 2 Region: 365-527
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.81e-49
Family Myf domain 0.0000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096N3E1
Sequence length 528
Comment (tr|A0A096N3E1|A0A096N3E1_PAPAN) Tyrosyl-tRNA synthetase {ECO:0000256|RuleBase:RU361234} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=YARS OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGDAPSPEEKLHLITRNLQEVLGEDKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIA
DFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKG
TDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVD
AQFGGVDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKED
VKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYTDLEKDFA
AEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEP
EEIIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGERVFVKGYEKGQPDEE
LKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS
Download sequence
Identical sequences A0A096N3E1 A0A2K5P269
XP_011935040.1.92194 ENSPANP00000006853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]