SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N3X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N3X7
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000195
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096N3X7
Sequence length 159
Comment (tr|A0A096N3X7|A0A096N3X7_PAPAN) Transforming growth factor alpha {ECO:0000313|Ensembl:ENSPANP00000007072} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=TGFA OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MVPSAGQLALFALGIVLAACQALENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSTLLKGRTACCHSETVV
Download sequence
Identical sequences A0A096N3X7
ENSPANP00000007072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]