SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N4D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N4D9
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily E set domains 1.45e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.46e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096N4D9
Sequence length 393
Comment (tr|A0A096N4D9|A0A096N4D9_PAPAN) Potassium voltage-gated channel subfamily J member 9 {ECO:0000313|Ensembl:ENSPANP00000007252} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=KCNJ9 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAQENAAFSPGPEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Download sequence
Identical sequences A0A096N4D9 A0A2K5L6M1 A0A2K6LEI7 A0A2K6RVD8
XP_001117363.1.72884 XP_007974723.1.81039 XP_007974724.1.81039 XP_007974725.1.81039 XP_007974726.1.81039 XP_007974727.1.81039 XP_007974728.1.81039 XP_007974729.1.81039 XP_007974730.1.81039 XP_011923055.1.92194 XP_011923056.1.92194 9544.ENSMMUP00000012988 ENSMMUP00000012988 ENSMMUP00000012988 ENSPANP00000018258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]