SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N541 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N541
Domain Number 1 Region: 35-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.37e-123
Family Bee venom hyaluronidase 0.0000107
Further Details:      
 
Weak hits

Sequence:  A0A096N541
Domain Number - Region: 423-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00219
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096N541
Sequence length 473
Comment (tr|A0A096N541|A0A096N541_PAPAN) Hyaluronoglucosaminidase {ECO:0000256|RuleBase:RU610713} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=HYAL2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MRAGPGPAVTLALVLAVAWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESEGLAVIDWEDWRPVWVRNWQDKDVYRRSSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPSHTPGEPQLRPVGELSWADLDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGFHLTSLLALAALAFTWTL
Download sequence
Identical sequences A0A096N541
ENSPANP00000007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]