SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N703 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N703
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096N703
Sequence length 587
Comment (tr|A0A096N703|A0A096N703_PAPAN) GRB2 associated binding protein 3 {ECO:0000313|Ensembl:ENSPANP00000008284} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=GAB3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVI
DLSECAVWKHVGPGFVRKEFQNNFVFIVKTTSRTFYLVAKTEQEMQVWVHSISQVCNLGH
LEDGTADSMESLSYTPSSLQPSSASSLHTAHAASSSLPRDDPNTNAVATEETRSESELLF
LPDYLVLSNCETGRLHHTSLPTRCDSWSNSDRSLEQASFDDVFVDCLQPLPSSHLVHPSC
HGNGAQEVPSSRPQPALIWSREINGPPRDHLSSSPLLESPLSSTIQVDKNQGSLPCGAKE
LDIMSNTPPPRPPKPSHLSERRQEEWSTHSGSKKPECTLVPRRISLSGLDSMRTWKADVE
GQSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNS
GSISSQLPELPADLEPPPVNRDLKPQRKPRPPPLDLRNLSTIREHASLTRTRTVPCSRTS
FLSPERNGINSARFFANPVSREEEESYIEMEEHRTTSSLSSGALTWTKKFSLDYLALDFN
SASPAPMQQKLLLSEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV
Download sequence
Identical sequences A0A096N703
ENSPANP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]