SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N7A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N7A2
Domain Number 1 Region: 80-270
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-66
Family Glutathione peroxidase-like 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096N7A2
Sequence length 271
Comment (tr|A0A096N7A2|A0A096N7A2_PAPAN) Peroxiredoxin 4 {ECO:0000313|Ensembl:ENSPANP00000008400} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PRDX4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MEALPLLAATTPAQGRHRRLLLLPLLLFLLPAGAVRGWETEDRPRTREEECHFYAGGQVY
PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Download sequence
Identical sequences A0A096N7A2 A0A2K5IE24 A0A2K5NFU6 A0A2K5TRG5 H9ER83
ENSMMUP00000028144 ENSMMUP00000028144 NP_001180740.1.72884 XP_005593228.1.63531 XP_011790494.1.43180 XP_011891031.1.92194 XP_014982569.1.72884 ENSPANP00000008400 9544.ENSMMUP00000028144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]