SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NAM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NAM1
Domain Number 1 Region: 279-465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-72
Family SPRY domain 0.00000000715
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-25
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 3 Region: 87-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NAM1
Sequence length 468
Comment (tr|A0A096NAM1|A0A096NAM1_PAPAN) Tripartite motif containing 21 {ECO:0000313|Ensembl:ENSPANP00000009756} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=TRIM21 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKDGGSVCPVCRQHFLL
RNLRPNRQLANMVDNLREISQEAREGAQEEQCAVHGERLHLFCEKDGKALCWVCAQSRKH
RDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAMKRADWKKTVETQKSRIHA
EFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAELAQQSQALQELISELERRRQGSA
LELLQEVIIVLERSESWNLKGLDIASPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWL
ILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCR
DSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQIGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGRNTAPLTLCPLNIG
Download sequence
Identical sequences A0A096NAM1
ENSPANP00000009756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]