SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NAP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NAP4
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.15e-16
Family Complement control module/SCR domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 4 Region: 35-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000863
Family Complement control module/SCR domain 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NAP4
Sequence length 392
Comment (tr|A0A096NAP4|A0A096NAP4_PAPAN) Membrane cofactor protein {ECO:0000256|PIRNR:PIRNR037971} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=CD46 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MALPGRRERPFSSGRFPGLLLATLVLQLSSFSDACEAPPTFEAMELIGKPKPYYKVGERV
DYKCKKGYFYIPPLATHSICDRNHTWLPVSDDGCYREMCPHIQDPVNGEAILVNGSYEFG
SELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGRHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVLPPSSTKSPTLSHS
VSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNSLDDWVIALIVIVIVVAVAV
ICVALYRFLQGRKKKGTYLTDENHREVKFTSL
Download sequence
Identical sequences A0A096NAP4
ENSPANP00000009779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]