SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NC34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NC34
Domain Number 1 Region: 259-485
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-64
Family Nuclear receptor ligand-binding domain 0.000000000877
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NC34
Sequence length 486
Comment (tr|A0A096NC34|A0A096NC34_PAPAN) Nuclear receptor subfamily 1 group H member 4 {ECO:0000313|Ensembl:ENSPANP00000010348} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NR1H4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MVMQFQELENPIQISPHCSCTPSGFFTEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGLYPQQPEEWYSPGIYELRRMPAESLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTMNEDSQG
RDLRQVTSTTKSCREKTELTPDQQNLLHYIMDSYSKQKMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
Download sequence
Identical sequences A0A096NC34
ENSPANP00000010348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]