SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NE42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NE42
Domain Number 1 Region: 9-156
Classification Level Classification E-value
Superfamily EF-hand 3.46e-27
Family Calmodulin-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NE42
Sequence length 163
Comment (tr|A0A096NE42|A0A096NE42_PAPAN) EF-hand calcium binding domain 11 {ECO:0000313|Ensembl:ENSPANP00000011150} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=EFCAB11 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MFFSEARARSRTWEASPSEHRMWVEVFKACDEDHKGYLSREDFKIAVVMLFGYKPSKIEV
DSVMSSVNPNTSGILLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAF
RQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYALNYGQKEA
Download sequence
Identical sequences A0A096NE42 A0A2K5MZA0 A0A2K6AIV1
ENSPANP00000011150 XP_011829699.1.47321 XP_011939052.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]