SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NF67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NF67
Domain Number 1 Region: 545-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000119
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  A0A096NF67
Domain Number - Region: 499-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NF67
Sequence length 591
Comment (tr|A0A096NF67|A0A096NF67_PAPAN) Complement C8 beta chain {ECO:0000313|Ensembl:ENSPANP00000011560} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=C8B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MKNSRTSAWRALVELFLLCAALGCLSLPGSRGERLHSFESNAVNKSFAKSRQMRNVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLRPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
VFTNSLEGSVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFSLKEYESYSDF
EHNVIEKAASSSGFSFGFKIPGIFELGISRQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVKLGVSIGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKIKVEPLYELVTATDFA
YSSTVKQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPIGSQGLACEVSYRK
NIPTDGKWNCWSSWSSCSGGRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Download sequence
Identical sequences A0A096NF67
ENSPANP00000011560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]