SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096NGE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NGE5
Domain Number 1 Region: 112-342,420-470
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-49
Family Kelch motif 0.0077
Further Details:      
 
Domain Number 2 Region: 43-139
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000196
Family Kelch motif 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096NGE5
Sequence length 522
Comment (tr|A0A096NGE5|A0A096NGE5_PAPAN) Kelch domain containing 4 {ECO:0000313|Ensembl:ENSPANP00000012019} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=KLHDC4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKRTQIVETPCPP
PSPRLNASLSVHPEKDELILFGGEYFNGQKTFLYNELYVYNIRKDAWTKVDIPSPPPRRC
AHQAVVVPQGGGQLWVFGGEFASPNGEQFYHYKDLWVLHLATKTWEQVKSTGGPSGRSGH
RMVAWKRQLILFGGFHESTRDYIYYNDVYAFNLDTFTWSKLSPSGMGPTPRSGCQMSVTP
QGGIVIYGGYSKQRVKKDVDKGTRHSDMFLLKPEDGREDKWVWTRMNPSGVKPTPRSGFS
VAMAPNHQTLFFGGVCDEEEEESLAGEFFNDLYFYDATRNRWFEGQLKGPKSEKKKRRRG
RREEPEGGSKLACGGAGTQAPVEVVKEVVTEDGTVVTIKQVLSAPGSAGQPQSEDEDSLE
EAGSPTSGPCPRSNTMLAVKHGVLYVYGGMFEAGDRQVTLSDLHCLDLHRMDAWKTLVEM
DPETQEWLEETDSEEDSEEVEGAEGGDEDEDEDSGEESGAED
Download sequence
Identical sequences A0A096NGE5
ENSPANP00000012019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]