SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NHP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NHP3
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 1.63e-40
Family FKBP immunophilin/proline isomerase 0.00000097
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 8.07e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 1.24e-25
Family FKBP immunophilin/proline isomerase 0.000000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NHP3
Sequence length 457
Comment (tr|A0A096NHP3|A0A096NHP3_PAPAN) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=FKBP5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MTTDEGAKNSGESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKSQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGERM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSPAAEEEKAEGHV
Download sequence
Identical sequences A0A096NHP3
ENSPANP00000012491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]