SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NII4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NII4
Domain Number 1 Region: 61-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.4e-22
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NII4
Sequence length 196
Comment (tr|A0A096NII4|A0A096NII4_PAPAN) Mitochondrial ribosomal protein S18A {ECO:0000313|Ensembl:ENSPANP00000012782} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=MRPS18A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAAFKGLVSAYGGLLRGLLAGPAATSWSRLPARGFREVVEIQEGKTTIIEGRLTATPKGS
PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVK
MAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNKVCMPVGSPL
LRDNVCYSRTPWKLYH
Download sequence
Identical sequences A0A096NII4 A0A0D9RI76 A0A2K5TSW2 H9FWJ2
ENSPANP00000012782 NP_001244564.1.72884 XP_005552952.1.63531 XP_007970625.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]