SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NIV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NIV6
Domain Number 1 Region: 58-244
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.21e-49
Family Astacin 0.00028
Further Details:      
 
Domain Number 2 Region: 415-584
Classification Level Classification E-value
Superfamily TRAF domain-like 4.74e-38
Family MATH domain 0.00085
Further Details:      
 
Domain Number 3 Region: 253-416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-29
Family MAM domain 0.0051
Further Details:      
 
Domain Number 4 Region: 657-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096NIV6
Sequence length 731
Comment (tr|A0A096NIV6|A0A096NIV6_PAPAN) Endopeptidase-2 {ECO:0000256|PIRNR:PIRNR001196} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=MEP1A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MHSLLYLVFCPHSSCIVHDADFGEQKDISEINLAAGLDLFQGDILLQNSRNGLRDPNTRW
KFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYIIFQQFNGCWSEVGDQ
HVGQNLSIGQGCDYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDEILSGYQHNFDTYD
DSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNR
MYNCTTTHTLLDHCTFEKANICGMIQGTTDDTDWVHQDSAQAGEVDHTLLGQCTGAGYFM
QLSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLIVWVRRDDSTGNVRKLV
KVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIYLDDITLTETPCPTGV
WTVQNFSQVLENTSKGDKLQSPRFYNSEGYGFGLTLYPHGRENSGYLRLAFHVCSGENDA
ILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKLHTSPVINDTVIWDRPSRVGTYHT
DCDCFRSIDFGWSGFISHQMLKRRSFLKNDDLIMFVDFEDITHLSQTEVPTKGKRLSPQS
LILQGQELQVSEEGSGKAMLEEVLPVSLSQGQPSRQKRSVENTGPLEDHNWPQYFRDPCD
PNPCQNDGVCVNVKGMASCRCISGPAFFYTGERCQAMQVHGSVLGMVIGGTAGVIFLTFS
IIAILSQRPRK
Download sequence
Identical sequences A0A096NIV6
ENSPANP00000012904 XP_011926056.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]