SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NJX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NJX1
Domain Number 1 Region: 18-161,190-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.89e-49
Family BAR domain 0.0094
Further Details:      
 
Domain Number 2 Region: 273-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NJX1
Sequence length 709
Comment (tr|A0A096NJX1|A0A096NJX1_PAPAN) SH3 domain binding protein 1 {ECO:0000313|Ensembl:ENSPANP00000013275} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=SH3BP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MMKRQLHRMRQLAQTGSLGRTPETAEFLGEHLLQVEQRLEPAKRAAHNVHKRLQACLQGQ
SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLE
RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGGPGSHS
HTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIHLLEIQADYHRR
SLSSLDTALAELRENHGQADHSPSMAATHFSRVYGVSLATHLHELGREIALPIEACVMML
LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
TFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGL
FSAVTLQDTVSDRLASEELPPSAVPTPTTTPAPAPAPVPAPALASAATKERTESEVPPRP
ASPKVTRSPPETAAPVEDMARRTKRPAPARPTMPPPQVSSSRSSPPAPPLPPGSGSPGTP
RALPRRLVGSSLRAPTVPPPLPPTPPQPARRQSRRSPASPSPASPGPASPSPASPGPASP
SPVSLSTPAQVDLGAATAEGGAPEAVGGVPTTPAIPPQPRPRSLASETN
Download sequence
Identical sequences A0A096NJX1
ENSPANP00000013275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]