SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NKH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NKH4
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.93e-30
Family G proteins 0.00089
Further Details:      
 
Domain Number 2 Region: 417-580
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.56e-19
Family G proteins 0.013
Further Details:      
 
Domain Number 3 Region: 168-268,310-349
Classification Level Classification E-value
Superfamily EF-hand 9.47e-16
Family Calmodulin-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NKH4
Sequence length 618
Comment (tr|A0A096NKH4|A0A096NKH4_PAPAN) Mitochondrial Rho GTPase {ECO:0000256|PIRNR:PIRNR037488} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RHOT2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSE
AEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTRGPRVPIILVGNKS
DLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQ
LRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGG
VWEDRLTLDGFLFLNTLFIQRGRHETTWTILRSFGYSDTLELTADYLFPPLHVPPGCSTE
LNHLGYQFVQRVFEKHDQDRDGALSPMELQSLFSVFPAAPWGPELLRTVRTEAGRLPLHG
YLCQWTLVTYLDVRSCLGHLGYLGYPTLCDQDSQTRAITVTREKRLDQEKGQTLRSVLLC
KVVGARGVGKSAFLQAFLGHGLGHQDTREQPPGYTIDTVQVNGQEKYLILCEVGTDDLAT
SLDAACDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGGVPVGPSPA
EFCRKHRLPAPVPFSCAGPAEPSTAIFTQLATMATFPHLVHAELHPSSFWLRGLLGVLGA
AMAAVLSFSLYRVLVKSQ
Download sequence
Identical sequences A0A096NKH4
ENSPANP00000013481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]