SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NKM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NKM9
Domain Number 1 Region: 299-361
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000576
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NKM9
Sequence length 489
Comment (tr|A0A096NKM9|A0A096NKM9_PAPAN) PHD finger protein 21B {ECO:0000313|Ensembl:ENSPANP00000013536} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PHF21B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTGPQVSSLQR
LAGQGAAVLPQVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTV
SHVPVPGSQPQALAEPAALASPLSSAGVAYAIISTSPSNAAAMAPSTAVSVVSDSIKVQP
LLISADNKVIIIQPQVQTQPESTAESRPPTEEPSQGAQATKKKKEDRPPTQENPEKIAFM
VALGLVTTEHLEEIQSKRQERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANED
PCWKNEITHDEHCAACKRGANLQPCGTCPGAYHLSCLDPPLKTAPKGVWVCPRCQHKALK
KDEGVPWTGMLAIVHSYVTHKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCL
ELKTNLLARQRGTQSSLDRLRALLRLIQGEQLLQVTMATTSPAPLLAGPWTKPSVAATHP
TLQHPQGHN
Download sequence
Identical sequences A0A096NKM9
ENSPANP00000013536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]