SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NLW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NLW6
Domain Number 1 Region: 455-763
Classification Level Classification E-value
Superfamily Folate-binding domain 9.42e-81
Family Aminomethyltransferase folate-binding domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 43-258,363-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.36e-54
Family FAD-linked reductases, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 260-362
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.28e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 4 Region: 765-858
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000213
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NLW6
Sequence length 879
Comment (tr|A0A096NLW6|A0A096NLW6_PAPAN) Pyruvate dehydrogenase phosphatase regulatory subunit {ECO:0000313|Ensembl:ENSPANP00000013974} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PDPR OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
VMFYRLLSIVGRQRASPGWQNWSSARNSASAAEARSMALPTQAQVVICGGGIMGTSVAYH
LSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYHQLEQETGIQT
GYTRTGSIFLAQTQDRLISLKRINSRLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNC
AGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGI
LSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPET
FTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVHGYPSENVWELDLKRF
GALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFE
RPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQ
ALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQQVHCWA
WLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGY
ANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFA
FWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLLQKQNGVYKRLTMFILDDHDTDLD
LWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINRGEY
EIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLHGK
Download sequence
Identical sequences A0A096NLW6 A0A2K5VLQ5
ENSMMUP00000030474 9544.ENSMMUP00000032321 ENSMMUP00000032321 ENSPANP00000013974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]