SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NMS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NMS7
Domain Number 1 Region: 33-209
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.44e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NMS7
Sequence length 221
Comment (tr|A0A096NMS7|A0A096NMS7_PAPAN) Phosphopantothenoylcysteine decarboxylase {ECO:0000313|Ensembl:ENSPANP00000014287} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PPCDC OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MEPRPGRLPELEATRPHMEPKASCPTAAPLVERKFHVLVGVTGSVAALKLPLLVSKLLDI
PGLEVAVVTTEGAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPL
DANTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVE
IPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
Download sequence
Identical sequences A0A096NMS7
ENSPANP00000014287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]