SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NQL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NQL1
Domain Number 1 Region: 699-831
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000137
Family Synaptotagmin-like (S variant) 0.0059
Further Details:      
 
Domain Number 2 Region: 7-42
Classification Level Classification E-value
Superfamily WW domain 0.00000000000312
Family WW domain 0.0011
Further Details:      
 
Domain Number 3 Region: 57-91
Classification Level Classification E-value
Superfamily WW domain 0.00000000101
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096NQL1
Sequence length 1192
Comment (tr|A0A096NQL1|A0A096NQL1_PAPAN) WW and C2 domain containing 2 {ECO:0000313|Ensembl:ENSPANP00000015321} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=WWC2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPLSFADCVGDELP
WGWEAGFDPQIGVYYIDHINKTTQIEDPRKQWRGEQEKMLKDYLSVAQDALRTQKELYHV
KEQRLALALDEYVRLNDAYKEKSSSRTSLFSGSSSSTKYDPDILKAEISTTRLRVKKLKR
ELSQMKQELLYKEQGFETLQQIDKKMSGGQSGYELSEAKAILTELKSIRKAISSGEKEKQ
DLMQSLAKLQERFHLDQNIGRSEPDLRSSPLSSHLSLSRQTLDAGSQTSISGDIGVRSRS
NLAEKVRLSLQYEEAKRSMANLKIELSKLDSEAWPGALDIEKEKLMLINEKEELLKELQF
VTPQKRTQDELERLEAERQRLEEELLSVRGAPSRALAERLRLEERRKELLQKLEETTRLT
TYLHSQLKSLSASTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSTELYYSSQSDQIDV
DYQYKLDFLLQEKSGYIPSGPITTIHENEVVKSPSQPGQSGLCGVAAAATGHTPPLAEAP
KSVASLSSRSSLSSLSPPGSPLVLEGTFPLSSHDASLHQFSADFEDCELSSHFADIGLVE
NQILLDSDSGGASQSLSEDKDLNECPGEPLYEGTADVEKSLPKRRVIHLLGEKTTCVSAA
VSDESVAGDSGVYEAFVKQPSEIEDVTYSEEDVAIVETAQVQIGLRYNAKSSSFMVIIAQ
LRNLHAFLIPLTSKVYFRVAVLPSSADVSCLFRTKVHPPTESILFNDVFRVAISQTALQQ
KTLRVDLCSVSRHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSV
FQPNQPLGDSIDLDAVSALLARTSAELLAVEQELAQEEEEEESGQEEQRGPDGDWLTMLR
EASNEIVAEKEAEVKLPEDSNCTEDLSSCPSVPEMNEDGNRKENNCAKDLRSQPPTGIPT
LVDKETNTDEAANDNMAVRPKEHSSLSSRQHPFVRSSVIVRSQTFSPGERSQYICRLNRS
DSDSSTLAKKSLFVRNSTERRSLRVKRTVCQSVLRRTAQECPVRTSLDLELDLQASLTRQ
SRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQKLLKQAEKQAEQSKEEQKQGL
NAEKLMRQVSKDVCRLREQSQKVPRQVQSFREKIAYFTRAKISIPSLPADDV
Download sequence
Identical sequences A0A096NQL1
ENSPANP00000015321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]