SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NRY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NRY0
Domain Number 1 Region: 226-355,610-725,1074-1187
Classification Level Classification E-value
Superfamily TPR-like 1.96e-96
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NRY0
Sequence length 1198
Comment (tr|A0A096NRY0|A0A096NRY0_PAPAN) Tetratricopeptide repeat domain 17 {ECO:0000313|Ensembl:ENSPANP00000015800} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=TTC17 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAVAVGVRGRYELPPCSGPGWLLSLSTLLSVAARGAFATTHWVVTEDGKIQQQVDSPMNL
KHPHDLVILMRQETTVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVP
LGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPQQPDCTKILELPYSIHAFQHLRGVQ
ERVNLSAPLLPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNSSSWVLYNMASFYWRIKN
EPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDSDFFTSYYT
LGNIYAMLGEYNHSVLCYDHALQAKPGFEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLN
ELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHS
LHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHS
ILWIWGRDSDAYRDKQHILWPKRADCTESYPRVPVGGELPTYFLPPENKGLRIHELSSDD
YSTEEEAQTPDCSITDFRKSHTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTVPE
EEIGSFLFHAINKPNAPVWLILNEAGLYWRAVGNSTFAIACLQRALNLAPLQYQDVPLVN
LANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYLALKNISGALEAFRQALKLTT
KCPECENSLKLIRCMQFYPFLYNITSSVCSGNCHEKTLDNSHDKQKYFDNSQSLDAAEEE
PSERGTEEDPVFSVENSGRDSDALRLESTVVEESNGSDEMENSDETKMSEEILALVDEFQ
QAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITFQVK
RVKKPKGDHKKTPGKKVETSQIENGHRYQANLEITGPKVASPGPQGKKRDYQRLGWPSPD
ECVKLRWVELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTLDHL
HGVSNRASLHYTGESQLTEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSMAAL
YWRVKGQGKKAIDCLRQALHYAPHQMKDVPLISLANILHNAKLWNDAVIVATMAVEIAPH
FAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVPAKNRIQTIQCHLMLKKGRRSP
Download sequence
Identical sequences A0A096NRY0
ENSPANP00000015800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]