SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NS84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NS84
Domain Number 1 Region: 88-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.13e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.000000592
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.79e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NS84
Sequence length 216
Comment (tr|A0A096NS84|A0A096NS84_PAPAN) Glutathione S-transferase zeta 1 {ECO:0000313|Ensembl:ENSPANP00000015904} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=GSTZ1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
ALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEFQLTWAQNTIISGFNALEQILQSTAGTYCVGDEVTMADLCLVPQVANAERFKVDC
TPYPTISSINKRLLVLEAFQVTHPCRQPDTPTELRA
Download sequence
Identical sequences A0A096NS84
ENSPANP00000015904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]