SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NTX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NTX5
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-38
Family Regulator of G-protein signaling, RGS 0.00000514
Further Details:      
 
Domain Number 2 Region: 764-844
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-26
Family DIX domain 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096NTX5
Sequence length 844
Comment (tr|A0A096NTX5|A0A096NTX5_PAPAN) Axin 2 {ECO:0000313|Ensembl:ENSPANP00000016496} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=AXIN2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSSAMLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQLGVGKGQVTKPVPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDAKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHNLEERLQQIREDEEKEGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHHSQYHS
LLPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRV
HCFCPGGPEYYCYSKCKSHPKALETMPGEQFGGSRGSTLPKRNGKGTEPGLALPAREGGA
PGGAGAMQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASR
HHLWGGNSAHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVAS
QQRDRNHSATVQAGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRR
MLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKV
ERID
Download sequence
Identical sequences A0A096NTX5
ENSPANP00000016496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]