SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NTY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NTY7
Domain Number 1 Region: 184-534
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-83
Family Protein kinases, catalytic subunit 0.000000386
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.06e-44
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NTY7
Sequence length 590
Comment (tr|A0A096NTY7|A0A096NTY7_PAPAN) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=GRK5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQ
VGRDLVSQTEEKLLQKPCKELFSACAQSVHEYLRGEPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSRKFSEEAESIC
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPDGTLSPDLNRN
HPPEPPKKGLLQRIFKRQHQNNSKSSPSSKTNFNHHINSNHVSSNSTGSS
Download sequence
Identical sequences A0A096NTY7 A0A2K5L696
ENSPANP00000016508 XP_011898484.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]