SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096NUT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NUT7
Domain Number 1 Region: 168-333
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-32
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 13-163
Classification Level Classification E-value
Superfamily Kelch motif 8.76e-27
Family Kelch motif 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NUT7
Sequence length 406
Comment (tr|A0A096NUT7|A0A096NUT7_PAPAN) Kelch domain containing 1 {ECO:0000313|Ensembl:ENSPANP00000016812} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=KLHDC1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MADSQLFCVAEERSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHL
MEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVNLRTRDGTYIWEKITNFEGQP
PTPRDKLSCWVYKDRLIYFGGYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKT
QTWFQPEIKGGVPPQPRAAHMCAVLGNKGYIFGGRVLQTRMNDLHYLNLDNWTWSGRITI
NGESPKHRSWHTLTPIADDKLFLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKTRPRL
WHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDCIGKNSIMLES
QISLLPPKLLQQVLKKITFWAAANHREEQRVQKEETEKKYQWISSN
Download sequence
Identical sequences A0A096NUT7
ENSPANP00000016812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]