SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NVI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NVI0
Domain Number 1 Region: 18-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-50
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 497-642
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-37
Family Ankyrin repeat 0.0004
Further Details:      
 
Domain Number 3 Region: 325-398
Classification Level Classification E-value
Superfamily EF-hand 0.0000000204
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NVI0
Sequence length 776
Comment (tr|A0A096NVI0|A0A096NVI0_PAPAN) Ankyrin repeat and EF-hand domain containing 1 {ECO:0000313|Ensembl:ENSPANP00000017055} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ANKEF1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MALVDKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTDPINGLSALHLASVSND
IDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFY
CILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLVFLEKGANPNAI
NSSTGRTALMEASREGVVELVRGILERGGEVNTFDNDRHHAAHFAAKGGFFDILKLLFAY
NGDVGLISLSGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAAS
KEIRRAERIANRLARPGAKNPNPLWALRLHDWSVEREAFLREAFSVLDRGDGTISKNDFV
MVLEERQEYASSEQLTAIAQLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKKKGM
GKKGKRGKFVLPLPICVIPEYVFPRRQDGGPPYYMIETYRNVTDNSRFNRDHPPEHPIQD
DSAWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDA
VKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGAFIDAVSINNSTPLNRAIE
SCRLDTVKYLLDIGAKFQLENRKGHTAMDVAKAYADYRIIGMIKEKLDNLPKPAENQKLK
GKTPPILKTEGPEIKKEEEPLSSIYGVPTTSEGKKVRKDNVVHLNSLITSGYTKKVDITF
IPRRIWSPEATTAELIRKRELRRERFTHEVDFEDFMMPFQKNITEKARALEAALKT
Download sequence
Identical sequences A0A096NVI0
ENSPANP00000017055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]