SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NWT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NWT4
Domain Number 1 Region: 873-1185
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.78e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000169
Further Details:      
 
Domain Number 2 Region: 1144-1445
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000148
Further Details:      
 
Domain Number 3 Region: 25-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-36
Family MAM domain 0.00000601
Further Details:      
 
Domain Number 4 Region: 381-580
Classification Level Classification E-value
Superfamily Fibronectin type III 5.97e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 5 Region: 279-415
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000149
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NWT4
Sequence length 1450
Comment (tr|A0A096NWT4|A0A096NWT4_PAPAN) Protein tyrosine phosphatase, receptor type U {ECO:0000313|Ensembl:ENSPANP00000017516} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PTPRU OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MASAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPTYLIIQ
LNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDG
GTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVSLCYHY
ILGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDV
PGGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISK
LRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESE
NTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARGLVHYF
GAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNCIRIAR
KAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYSYYPKP
VNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRSGGVTE
ASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGW
DATKKKDKVKGSRQEPMPPLPTCSVFTDDRHRVKLHPMLGDPNADYINANYIDVSALPGP
ASSASPGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKITL
VKTETLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPP
DARPIVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIF
IHDAILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECS
IALLPRNRDKNRSMDVLPPDRCLPFLISTDGDPNNYINAALTDSYTRSAAFIVTLHPLQS
TTPDFWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDL
VARVFRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRT
IVHCLNGGGRSGTFCACSTVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVA
LEYLEGLESR
Download sequence
Identical sequences A0A096NWT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]