SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NY57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NY57
Domain Number 1 Region: 428-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000327
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 366-433
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000481
Family LIM domain 0.0084
Further Details:      
 
Domain Number 3 Region: 338-364
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000048
Family LIM domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NY57
Sequence length 538
Comment (tr|A0A096NY57|A0A096NY57_PAPAN) Ajuba LIM protein {ECO:0000313|Ensembl:ENSPANP00000018017} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=AJUBA OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPGGPPPTRALPLPQSLPPDFRLEATAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAAAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPGPGQPWS
SSRGRSGSGGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTSGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMRESEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQAPANYI
Download sequence
Identical sequences A0A096NY57
ENSPANP00000018017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]